Sale!

wetakeprideintreatingeachandeverycustomerweserveasiftheywerefamilymembershelpingcustomerslocateephb1ephb2ephb3antibodycatcsbpa106334genebiosystemsiswhatwedo0.jpg

EPHB1/EPHB2/EPHB3 Antibody – Cat. #: CSB-PA106334 Gene Bio Systems

Original price was: $ 772,20.Current price is: $ 231,66.

SKU: mode_6912202113124 Category: Uncategorized Tag: PRIMARY ANTIBODIES

Description
shopping

Size :100ul

Clone Number:

Aliases:Cek 6 antibody; EK6 antibody; ELK antibody; Elkh antibody; EPH receptor B1 antibody; Eph tyrosine kinase 2 antibody; EPH-like kinase 6 antibody; Ephb1 antibody; EPHB1_HUMAN antibody; Ephrin type B receptor 1 antibody; Ephrin type-B receptor 1 antibody; EPHT2 antibody; HEK 6 antibody; HEK6 antibody; NET antibody; Neuronally-expressed EPH-related tyrosine kinase antibody; soluble EPHB1 variant 1 antibody; Tyrosine protein kinase receptor EPH 2 antibody; Tyrosine-protein kinase receptor EPH-2 antibody

Product Type:Polyclonal Antibody

Immunogen Species:Homo sapiens (Human)

UniProt ID:P54762

Immunogen:Synthesized peptide derived from internal of Human EPHB1/2/3.

Raised in:Rabbit

Species Reactivity:Human, Mouse

Tested Applications:ELISA, IHC, IF; IHC:1:50-1:100, IF:1:100-1:500

Background:Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. Beside its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively.

Tang X.X., Genomics 29:426-437(1995).
Zhang Z., Protein Sci. 13:2819-2824(2004).
Stein E., J. Biol. Chem. 271:23588-23593(1996).

Clonality:Polyclonal

Isotype:IgG

Purification Method:The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.

Conjugate:Non-conjugated

Buffer:Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Form:liquid

Stroage:Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.

Target Names:EPHB1/EPHB2/EPHB3

Research Areas:Neuroscience;Cardiovascular

Prompt Shipping and professional packaging

Because of our long-standing partnership in a long-standing partnership with UPS, FedEx, DHL and a variety of other leading global carriers, we can provide a variety of shipping options. Our warehouse staff are highly trained to package your goods exactly as per the specifications we offer. Your goods are thoroughly checked and securely secured prior to shipment. We deliver to thousands of customers every day from all over the world. This shows that we're committed to being the largest retailer online in the world. The warehouses and centers of distribution are situated in Europe, as well as the USA.

Note: Orders that contain more than one item are assigned a particular processing time, based on the individual item.

Prior to shipping We will inspect thoroughly the items you have ordered. The majority of orders will be sent within 48 hours. It is expected that delivery will take between three and seven days.

Returns

The inventory is always changing and we do not completely manage it due to the fact that several parties are involved, including our factory and warehouse. The actual stock levels can fluctuate at any moment. Be aware that it is possible that your order will run out of stock even after you've placed your order.

Our policy runs for 30 days. However, if 30 days have passed from the date you purchased the item, we cannot give you a refund or exchange.

To be eligible for a return, your product must be unopened and in the same condition as when you received it. The item must be in its original packaging.

EPHB1/EPHB2/EPHB3 Antibody – Cat. #: CSB-PA106334 Gene Bio Systems

Related products

Login