Sale!

weareproudofgivingeachcustomerweserveasiftheyarefamilymembershelpingpeoplefindtheghitmantibodycatcsbpa927206genebiosystems0.jpg

GHITM Antibody – Cat. #: CSB-PA927206 Gene Bio Systems

Original price was: $ 772,20.Current price is: $ 231,66.

SKU: mode_6912067469412 Category: Uncategorized Tag: PRIMARY ANTIBODIES

Description
shopping

Size :100ul

Clone Number:

Aliases:Dermal papilla derived protein 2 antibody; Dermal papilla-derived protein 2 antibody; DERP2 antibody; Ghitm antibody; GHITM_HUMAN antibody; Growth hormone inducible transmembrane protein antibody; Growth hormone-inducible transmembrane protein antibody; HSPC282 antibody; MICS1 antibody; Mitochondrial morphology and cristae structure 1 antibody; My021 antibody; PTD010 antibody; TMBIM5 antibody; Transmembrane BAX inhibitor motif containing 5 antibody; Transmembrane BAX inhibitor motif containing protein 5 antibody; Transmembrane BAX inhibitor motif-containing protein 5 antibody

Product Type:Polyclonal Antibody

Immunogen Species:Homo sapiens (Human)

UniProt ID:Q9H3K2

Immunogen:Synthesized peptide derived from internal of Human GHITM.

Raised in:Rabbit

Species Reactivity:Human

Tested Applications:ELISA, WB; WB:1:500-1:3000

Background:Required for the mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c.

Ikeda A., Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases.
Mei G., Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases.
Mao Y.M., Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases.

Clonality:Polyclonal

Isotype:IgG

Purification Method:The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.

Conjugate:Non-conjugated

Buffer:Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Form:liquid

Stroage:Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.

Target Names:GHITM

Research Areas:Cancer;Cell biology;Tags & Cell Markers;Metabolism

Prompt Shipping and professional packaging

Because of our long-standing partnership in a long-standing partnership with UPS, FedEx, DHL and a variety of other leading global carriers, we can provide a variety of shipping options. Our warehouse staff are highly trained to package your goods exactly as per the specifications we offer. Your goods are thoroughly checked and securely secured prior to shipment. We deliver to thousands of customers every day from all over the world. This shows that we're committed to being the largest retailer online in the world. The warehouses and centers of distribution are situated in Europe, as well as the USA.

Note: Orders that contain more than one item are assigned a particular processing time, based on the individual item.

Prior to shipping We will inspect thoroughly the items you have ordered. The majority of orders will be sent within 48 hours. It is expected that delivery will take between three and seven days.

Returns

The inventory is always changing and we do not completely manage it due to the fact that several parties are involved, including our factory and warehouse. The actual stock levels can fluctuate at any moment. Be aware that it is possible that your order will run out of stock even after you've placed your order.

Our policy runs for 30 days. However, if 30 days have passed from the date you purchased the item, we cannot give you a refund or exchange.

To be eligible for a return, your product must be unopened and in the same condition as when you received it. The item must be in its original packaging.

GHITM Antibody – Cat. #: CSB-PA927206 Gene Bio Systems

Related products

Login